Overview
Long Name
|
Antibody Type
|
Antibody Isotype
|
Host
|
Species Reactivity
|
Validated Applications
|
Purification
|
| angiotensin II receptor, type 2 |
Polyclonal |
IgG |
Rabbit |
Human, Rat |
WB |
Immunogen affinity purified. |
Immunogen
|
| A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids. |
Properties
Form
|
Lyophilized |
Size
|
100 µg/vial |
Contents
|
Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request. |
Concentration
|
Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration). |
Storage
|
At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing. |
Additional Information Regarding the Antigen
Gene
|
AGTR2 |
Protein
|
Type-2 angiotensin II receptor |
Uniprot ID
|
P50052 |
Function
|
Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation. |
Tissue Specificity
|
In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine. |
Sub-cellular localization
|
Cell membrane; Multi-pass membrane protein. |
Sequence Similarities
|
Belongs to the G-protein coupled receptor 1 family. |
Aliases
|
AGTR 2 antibody|Agtr2 antibody|AGTR2_HUMAN antibody|angiotensin II receptor type 2 antibody|Angiotensin II type-2 receptor antibody|Angiotensin receptor 2 antibody|AT 2 antibody|AT2 antibody|ATGR 2 antibody|ATGR2 antibody|MRX 88 antibody|MRX88 antibody|Type 2 angiotensin II receptor antibody|Type-2 angiotensin II receptor antibody |
Application Details
| Application |
Concentration* |
Species |
Validated Using** |
| Western blot |
0.1-0.5μg/ml |
Human, Rat |
AssaySolution's ECL kit |
AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information.
Anti- AGTR2 antibody, ASA-B0051, Western blotting
All lanes: Anti AGTR2 (ASA-B0051) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 47KD
Observed band size: 47KD
