5HT2A Receptor Antibody

Catalog Number: ASA-B0007
Lead time: 1 week
$295.00

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled Polyclonal IgG Rabbit Human, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human 5HT2A Receptor (400-431aa KENKKPLQLILVNTIPALAYKSSQLQMGQKKN) , different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

HTR2A

Protein

5-hydroxytryptamine receptor 2A

Uniprot ID

P28223

Function

G-protein coupled receptor for 5-hydroxytryptamine (serotonin). Also functions as a receptor for various drugs and psychoactive substances, including mescaline, psilocybin, 1-(2,5- dimethoxy-4-iodophenyl)-2-aminopropane (DOI) and lysergic acid diethylamide (LSD). Ligand binding causes a conformation change that triggers signaling via guanine nucleotide-binding proteins (G proteins) and modulates the activity of down-stream effectors. Beta-arrestin family members inhibit signaling via G proteins and mediate activation of alternative signaling pathways. Signaling activates phospholipase C and a phosphatidylinositol-calcium second messenger system that modulates the activity of phosphatidylinositol 3-kinase and promotes the release of Ca(2+) ions from intracellular stores. Affects neural activity, perception, cognition and mood. Plays a role in the regulation of behavior, including responses to anxiogenic situations and psychoactive substances. Plays a role in intestinal smooth muscle contraction, and may play a role in arterial vasoconstriction.

Tissue Specificity

Detected in brain cortex (at protein level). Detected in blood platelets.

Sub-cellular localization

Cell membrane; Multi-pass membrane protein. Cell projection, dendrite . Cell projection, axon . Cytoplasmic vesicle . Membrane, caveola . Note: Localizes to the postsynaptic thickening of axo-dendritic synapses.

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Aliases

5 HT 2 antibody|5 HT 2A antibody|5 HT2 receptor antibody|5 HT2A antibody|5 hydroxytryptamine receptor 2A antibody|5-HT-2 antibody|5-HT-2A antibody|5-hydroxytryptamine (serotonin) receptor 2A, G protein-coupled antibody|5-hydroxytryptamine 2A receptor antibody|5-hydroxytryptamine receptor 2A antibody|5HT2A_HUMAN antibody|HTR 2 antibody|HTR 2A antibody|HTR2 antibody|HTR2, formerly antibody|HTR2A antibody| serotonin 5-HT-2 receptor, formerly antibody|serotonin 5-HT-2A receptor antibody|Serotonin receptor 2A antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Rat AssaySolution's ECL kit


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

 Anti- 5HT2A
Anti- 5HT2A Receptor antibody, ASA-B0007, Western blotting
All lanes: Anti 5HT2A Receptor (ASA-B0007) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Rat Testis Tissue Lysate at 50ug
Lane 3: U87 Whole Cell Lysate at 40ug
Predicted band size: 53KD
Observed band size: 53KD
 
 
 
 
 
 
 
Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Newsletter