ABCA1 Antibody

Catalog Number: ASA-B0012
Lead time: 1 week
$295.00

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

ATP-binding cassette, sub-family A (ABC1), member 1 Polyclonal IgG Rabbit Human, Mouse, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human ABCA1 (2231-2261aa KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV), identical to the related mouse sequence.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

ABCA1

Protein

ATP-binding cassette sub-family A member 1

Uniprot ID

O95477

Function

cAMP-dependent and sulfonylurea-sensitive anion transporter. Key gatekeeper influencing intracellular cholesterol transport.

Tissue Specificity

Widely expressed, but most abundant in macrophages.

Sub-cellular localization

Membrane.

Sequence Similarities

Belongs to the ABC transporter superfamily. ABCA family.

Aliases

ABC 1 antibody|ABC Transporter 1 antibody|ABC-1 antibody|ABC1 antibody|ABCA 1 antibody| ABCA1 antibody|ABCA1_HUMAN antibody|ATP binding Cassette 1 antibody|ATP binding cassette sub family A ABC1 member 1 antibody|ATP binding cassette sub family A member 1 antibody|ATP binding Cassette Transporter 1 antibody|ATP-binding cassette 1 antibody|ATP-binding cassette sub-family A member 1 antibody|ATP-binding cassette transporter 1 antibody|CERP antibody|Cholesterol efflux regulatory protein antibody|FLJ14958 antibody| HDLDT1 antibody|Membrane bound antibody|MGC164864 antibody|MGC165011 antibody|TD antibody|TGD antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Mouse, Rat AssaySolution's ECL kit


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information

Anti-ABCA1 antibody
Anti- ABCA1 antibody, ASA-B0012, Western blotting
All lanes: Anti ABCA1 (ASA-B0012) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: Mouse Liver Tissue Lysate at 50ug
Lane 3: SMMC Whole Cell Lysate at 40ug
Predicted band size: 254KD
Observed band size: 254KD
 
 
 
 
 
 
 
Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Newsletter