ACTH Antibody

Catalog Number: ASA-B0027
Lead time: 1 week
$295.00

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

proopiomelanocortin Polyclonal IgG Rabbit Human, Mouse, Rat IHC-P Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence in the middle region of human ACTH(138-176aa SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF), different from the related mouse and rat sequences by two amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

POMC

Protein

Pro-opiomelanocortin

Uniprot ID

P01189

Function

ACTH stimulates the adrenal glands to release cortisol.

Tissue Specificity

ACTH and MSH are produced by the pituitary gland.

Sub-cellular localization

Secreted.

Sequence Similarities

Belongs to the POMC family.

Aliases

ACTH antibody|Adrenocorticotropic hormone antibody|Adrenocorticotropin antibody|Adrenocorticotropin Hormone antibody|Alpha Melanocyte Stimulating Hormone antibody|alpha-MSH antibody|alphaMSH antibody|Beta Endorphin antibody|Beta Lipotropin antibody|Beta LPH antibody|Beta Melanocyte Stimulating Hormone antibody|Beta-endorphin antibody|beta-MSH antibody|CLIP antibody|Corticotropin antibody|Corticotropin Like Intermediary Peptide antibody|Corticotropin lipotropin antibody|Corticotropin lipotropin precursor antibody|Corticotropin-like intermediary peptide antibody|Gamma LPH antibody|gamma-MSH antibody|Lipotropin Beta antibody|Lipotropin Gamma antibody|Lipotropin, included antibody|LPH antibody|Melanocyte-stimulating hormone, included antibody|Melanotropin Alpha antibody|Melanotropin beta antibody|Melanotropin gamma antibody|Melanotropin, included antibody|Met Enkephalin antibody|Met-enkephalin antibody|MSH antibody|NPP antibody|Opiomelanocortin prepropeptide antibody|POC antibody|POMC antibody|Pomc-1 antibody|Pomc1 antibody|Pomc2 antibody|Pro ACTH endorphin antibody|Pro opiomelanocortin antibody|Pro-opiomelanocortin-alpha antibody|Proopiomelanocortin antibody|Proopiomelanocortin preproprotein antibody|Tetracosactide antibody

Application Details

Application Concentration* Species Validated Using**
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Mouse, Rat, Human AssaySolution's IHC/ICC Detection kit


AssaySolution recommends Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

 
 
 
nti-ACTHratbrai
Anti-ACTH antibody, ASA-B0027, IHC(P)
Rat Brain Tissue
 
Anti-ACTHratkidney
Anti-ACTH antibody, ASA-B0027, IHC(P)
Rat Kidney Tissue
 
Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Newsletter