AGTR2 Antibody

Catalog Number: ASA-B0051
Lead time: 1 week
$295.00

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

angiotensin II receptor, type 2 Polyclonal IgG Rabbit Human, Rat WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human AGTR2 (333-363aa FRVPITWLQGKRESMSCRKSSSLREMETFVS), different from the related mouse sequence by three amino acids, and from the related rat sequence by two amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

AGTR2

Protein

Type-2 angiotensin II receptor

Uniprot ID

P50052

Function

Receptor for angiotensin II. Cooperates with MTUS1 to inhibit ERK2 activation and cell proliferation.

Tissue Specificity

In adult, highly expressed in myometrium with lower levels in adrenal gland and fallopian tube. Expressed in the cerebellum. Very highly expressed in fetal kidney and intestine.

Sub-cellular localization

Cell membrane; Multi-pass membrane protein.

Sequence Similarities

Belongs to the G-protein coupled receptor 1 family.

Aliases

AGTR 2 antibody|Agtr2 antibody|AGTR2_HUMAN antibody|angiotensin II receptor type 2 antibody|Angiotensin II type-2 receptor antibody|Angiotensin receptor 2 antibody|AT 2 antibody|AT2 antibody|ATGR 2 antibody|ATGR2 antibody|MRX 88 antibody|MRX88 antibody|Type 2 angiotensin II receptor antibody|Type-2 angiotensin II receptor antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Rat AssaySolution's ECL kit


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot. *Blocking peptide can be purchased at $65. Contact us for more information.

Anti- AGTR2
Anti- AGTR2 antibody, ASA-B0051, Western blotting
All lanes: Anti AGTR2 (ASA-B0051) at 0.5ug/ml
Lane 1: Rat Liver Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 47KD
Observed band size: 47KD
 
 
 
 
 
 
 
Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Newsletter