AHSG Antibody

Catalog Number: ASA-B0054
Lead time: 1 week
$295.00

Overview

Long Name

Antibody Type

Antibody Isotype

Host

Species Reactivity

Validated Applications

Purification 

alpha-2-HS-glycoprotein Polyclonal IgG Rabbit Human, Rat ELISA, IHC-P, WB Immunogen affinity purified.

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of human AHSG (33-65aa DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE), different from the related mouse and rat sequences by thirteen amino acids.

Properties

Form

Lyophilized

Size

100 µg/vial

Contents

Antibody is lyophilized with 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg NaN3. *carrier free antibody available upon request.

Concentration

Reconstitute with 0.2 ml sterile dH2O (500 µg/ml final concentration).

Storage

At -20 °C for 12 months, as supplied. Store reconstituted antibody at 2-8 °C for one month. For long-term storage, aliquot and store at -20 °C. Avoid repeated freezing and thawing.

Additional Information Regarding the Antigen

Gene

AHSG

Protein

Alpha-2-HS-glycoprotein

Uniprot ID

P02765

Function

Promotes endocytosis, possesses opsonic properties and influences the mineral phase of bone. Shows affinity for calcium and barium ions.

Tissue Specificity

Synthesized in liver and selectively concentrated in bone matrix. Secreted in plasma. It is also found in dentin in much higher quantities than other plasma proteins.

Sub-cellular localization

Secreted.

Sequence Similarities

Belongs to the fetuin family.

Aliases

59 kDa bone sialic acid-containing protein antibody|A2HS antibody|Aa2-066 antibody|AHS antibody|Ahsg alpha-2-HS-glycoprotein antibody| Ahsg antibody|Alpha 2 HS Glycoprotein antibody|Alpha 2 Z globulin antibody|Alpha-2-HS-glycoprotein antibody|Alpha-2-HS-glycoprotein chain B antibody|Alpha-2-Z-globulin antibody|Asialofetuin antibody|Ba alpha 2 glycoprotein antibody|Ba-alpha-2-glycoprotein antibody|BSP antibody| Countertrypin antibody|Fetua antibody|FETUA_HUMAN antibody|Fetuin, mouse, homolog of antibody|Fetuin A antibody|Fetuin-A antibody| Glycoprotein PP63 antibody|HSGA antibody|pp63 antibody

Application Details

Application Concentration* Species Validated Using**
Western blot 0.1-0.5μg/ml Human, Rat AssaySolution's ECL kit
Immunohistochemistry(Paraffin-embedded Section) 0.5-1μg/ml Human AssaySolution's IHC/ICC Detection kit
ELISA 0.1-0.5μg/ml Human Sandwich ELISA format


AssaySolution recommends Rabbit Chemiluminescent WB Detection Kit (AKIT001B) for Western blot, and Rabbit Peroxidase IHC/ICC Detection Kit (AKIT002B) for IHC(P). *Blocking peptide can be purchased at $65. Contact us for more information

Anti- AHSG
Anti- AHSG antibody, ASA-B0054, Western blotting
All lanes: Anti AHSG (ASA-B0054) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: HELA Whole Cell Lysate at 40ug
Predicted band size: 39KD
Observed band size: 39KD
 
Anti-AHSGhuman.
Anti- AHSG antibody, ASA-B0054, IHC(P)
Human Liver Cancer Tissue
 
 
 
 
Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Newsletter