Exendin-4 ELISA Kit

Catalog Number: AYQ-E11340
Lead time: 3-4 business days
*
$0.00
Products specifications
Storage Store the unopened product at 2 - 8° C. Protect from light. Do not use past expiration date.
Kit Components Assay plate (12 x 8 coated Microwells), Standard (Freeze dried), Biotin-antibody (60 x concentrate), HRP-avidin (20 x concentrate), Biotin-antibody Diluent, HRP-avidin Diluent, Sample Diluent, Wash Buffer (20 x concentrate), TMB Substrate, Stop Solution, Adhesive Strip (For 96 wells), Instruction manual
Notes Please contact our Technical Services with any questions regarding species reactivity
Standard Curve Range 78.125 -- 5000 pg/ml
Sensitivity 62.5 pg/ml
Inter Assay CV%<10%
Intra Assay CV%<8%
Assay Type Sandwich ELISA
Suitable Sample Type serum, plasma, tissue homogenates, cell lysate, cell culture medium.
Sample Volume 50-100ul
Applications ELISA
Background Exendin-4 is a 39 amino acid peptide found in venom from the Gila monster Heloderma suspectum. It is a member of the glucagon-secretin family of peptide hormones and neuropeptides. Exendin-4 is a potent agonist of the GLP-1 receptor and hence a potent stimulator of insulin secretion.
Gene Symbol Exendi n-4
Species Heloderma suspectum (Gila monster)
Antigen Amino Acid Sequence HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2