Exendin-4 ELISA Kit

Catalog Number: AYQ-E11340

Lead time: 3-4 business days

Please choose size: *

$0.00

Qty:

Product Attachments

Products specifications

Storage	Store the unopened product at 2 - 8° C. Protect from light. Do not use past expiration date.
Kit Components	Assay plate (12 x 8 coated Microwells), Standard (Freeze dried), Biotin-antibody (60 x concentrate), HRP-avidin (20 x concentrate), Biotin-antibody Diluent, HRP-avidin Diluent, Sample Diluent, Wash Buffer (20 x concentrate), TMB Substrate, Stop Solution, Adhesive Strip (For 96 wells), Instruction manual
Notes	Please contact our Technical Services with any questions regarding species reactivity
Standard Curve Range	78.125 -- 5000 pg/ml
Sensitivity	62.5 pg/ml
Inter Assay	CV%<10%
Intra Assay	CV%<8%
Assay Type	Sandwich ELISA
Suitable Sample Type	serum, plasma, tissue homogenates, cell lysate, cell culture medium.
Sample Volume	50-100ul
Applications	ELISA
Background	Exendin-4 is a 39 amino acid peptide found in venom from the Gila monster Heloderma suspectum. It is a member of the glucagon-secretin family of peptide hormones and neuropeptides. Exendin-4 is a potent agonist of the GLP-1 receptor and hence a potent stimulator of insulin secretion.
Gene Symbol	Exendi n-4
Species	Heloderma suspectum (Gila monster)
Antigen Amino Acid Sequence	HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2

Assay Solution's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

Exendin-4 ELISA Kit

Product Attachments

Information

Customer service

My account

Follow us